PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6AS_D6ABA1D79.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 262aa    MW: 28762.7 Da    PI: 8.5942
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6AS_D6ABA1D79.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.12.1e-274695251
                           ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           rie+ + rqvtfskRr g+lKKA+EL vLCdaeva+i+fs++g+lyey+s
  Traes_6AS_D6ABA1D79.1 46 RIEDATSRQVTFSKRRSGLLKKAFELGVLCDAEVALIVFSPRGRLYEYAS 95
                           8***********************************************86 PP

2K-box73.27.7e-25119212699
                  K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                            ++++ +a  + ++ e++ Lk +i+ ++  qR+l Ge+L+s+s  eLq+Le qLeksl+ iR+kK++ +l++i el++ke++l  en  
  Traes_6AS_D6ABA1D79.1 119 TVEQPAAGVQMCRSEATALKHKIDAIEAYQRKLSGEGLGSCSAHELQELELQLEKSLSCIRQKKQQKMLDKILELKEKERKLLTENSV 206
                            444677888999**************************************************************************** PP

                  K-box  94 Lrkkle 99 
                            Lrk+++
  Traes_6AS_D6ABA1D79.1 207 LRKEYK 212
                            **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-343796IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.1283797IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.72E-2939112IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-283959IPR002100Transcription factor, MADS-box
CDDcd002659.24E-3643112No hitNo description
PfamPF003192.6E-254693IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-285974IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-287495IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.928127217IPR002487Transcription factor, K-box
PfamPF014862.4E-24128211IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MAPSSPPAAA VAAEGDEQQQ QIVVAAAAAA AAKKGGGKRG RREMRRIEDA TSRQVTFSKR  60
RSGLLKKAFE LGVLCDAEVA LIVFSPRGRL YEYASAPDLQ KTIDRYLNHT KGTSTNEKTV  120
EQPAAGVQMC RSEATALKHK IDAIEAYQRK LSGEGLGSCS AHELQELELQ LEKSLSCIRQ  180
KKQQKMLDKI LELKEKERKL LTENSVLRKE YKALPLLELA TAAAAERSPD GAGAEEAEED  240
ERRRHYMEVE TELVIGRPGS SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J3e-1839121285Myocyte-specific enhancer factor 2A
3p57_I3e-1839121285Myocyte-specific enhancer factor 2A
3p57_D3e-1839121285Myocyte-specific enhancer factor 2A
3p57_C3e-1839121285Myocyte-specific enhancer factor 2A
3p57_B3e-1839121285Myocyte-specific enhancer factor 2A
3p57_A3e-1839121285Myocyte-specific enhancer factor 2A
3kov_J3e-1839121285Myocyte-specific enhancer factor 2A
3kov_I3e-1839121285Myocyte-specific enhancer factor 2A
3kov_B3e-1839121285Myocyte-specific enhancer factor 2A
3kov_A3e-1839121285Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ5123400.0DQ512340.1 Triticum aestivum MADS-box transcription factor TaAGL23 (AGL23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233660.11e-100PREDICTED: MADS-box protein SOC1
SwissprotA2Z9Q76e-65MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLW5GGE50.0W5GGE5_WHEAT; Uncharacterized protein
STRINGORGLA02G0003200.12e-79(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-47AGAMOUS-like 20
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]